Skip to main content

Table 2 Detected phosphopeptides at 30 °C and 18 °C reactions, with each phosphorylated residue marked with star

From: Crystal structure of diamondback moth ryanodine receptor Repeat34 domain reveals insect-specific phosphorylation sites

Sequence Theo.MH+ [Da] DeltaM [ppm] Site1 Site2 Site3
30 °C
 FS*EHYHDAWASR 1585.62198 − 0.15 2863   
 IENS*WVYGENWSDSQK 2021.82768 6.01 2878   
 KIENS*WVYGENWSDSQK 2149.92264 0.14 2878   
 KIENS*WVYGENWSDS*QKAHPR 2611.17254 − 1.34 2888   
 YKEPVRES*LK 1328.66099 0.88 2916   
 EPVRES*LK 1037.5027 0.5 2916   
 ALLAIGWSVEHS*EVDIPSTNR 2374.14387 2.47 2930   
 ALLAIGWSVEHSEVDIPS*TNRSSMR 2835.34952 5.99 2936   
 RQS*KSGGRPVDVVTDSATPFNYNPHPVDMTNLTLSR 4052.92842 1.35 2946   
 S*GGRPVDVVTDSATPFNYNPHPVDMTNLTLSR 3553.64174 10.58 2948   
 SGGRPVDVVTDS*ATPFNYNPHPVDMT*NLT*LSR 3713.5744 12.04 2959 2973 2976
 SGGRPVDVVTDSATPFNYNPHPVDMT*NLTLSR 3537.64682 9.43 2973   
 S*QEFLK 831.36481 − 0.65 3033   
 DRERS*QEFLK 1387.63657 − 0.1 3033   
 ERS*QEFLK 1116.50852 0.42 3033   
18 °C
 KIENS*WVYGENWSDSQK 2149.92264 − 0.2 2878   
 ERS*QEFLK 1116.50852 1.07 2916   
 ALLAIGWSVEHSEVDIPS*TNRSSMRR 3007.44554 1.03 2936   
 YKEPVRES*LK 1328.66099 − 0.45 3033